PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00012115-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family HD-ZIP
Protein Properties Length: 279aa    MW: 31291 Da    PI: 7.0423
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00012115-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.6e-19136190256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  SMil_00012115-RA_Salv 136 RKKLRLSKEQAAVLEETFKEHNTLNPKQKMALAKQLNLRPRQVEVWFQNRRARTK 190
                            788899***********************************************98 PP

2HD-ZIP_I/II128.33.1e-41136225191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rlskeq+++LEe+F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+kev+eLr
  SMil_00012115-RA_Salv 136 RKKLRLSKEQAAVLEETFKEHNTLNPKQKMALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCENLTEENRRLQKEVNELR 223
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             +l
  SMil_00012115-RA_Salv 224 -AL 225
                            .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046188.8E-251114IPR006712HD-ZIP protein, N-terminal
PROSITE profilePS5007117.346132192IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-18132195IPR009057Homeodomain-like
SMARTSM003891.8E-15134196IPR001356Homeobox domain
SuperFamilySSF466891.11E-18135201IPR009057Homeodomain-like
PfamPF000462.1E-16136190IPR001356Homeobox domain
CDDcd000869.41E-16136193No hitNo description
PROSITE patternPS000270167190IPR017970Homeobox, conserved site
PfamPF021834.9E-11192226IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.3E-25192235IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MAERDDGLGL SLSLRCPETH NHDPPPPPPP SRPTAASSSS FPFNLFRSPL PFMHHQHNSD  60
AFHQSSDGNM EARSIFGGID VNKAITVIDC DEEVMVSSPN STVSSLSGKR SEREENEGER  120
ASSSLEIDDD GDAAARKKLR LSKEQAAVLE ETFKEHNTLN PKQKMALAKQ LNLRPRQVEV  180
WFQNRRARTK LKQTEVDCEY LRRCCENLTE ENRRLQKEVN ELRALKLSPQ LYMNMSPPTT  240
LTMCPQCERV AVSSSSSSSA AAHHHQRPPP PWAALDPRT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184192RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-149PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466028e-91HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP951e-123A0A068UP95_COFCA; Uncharacterized protein
STRINGSolyc01g090460.2.11e-114(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.16e-83homeobox-leucine zipper protein 3